PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_141360_mzxu.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family TCP
Protein Properties Length: 314aa    MW: 36170.9 Da    PI: 9.9026
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_141360_mzxu.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP136.52.4e-42922233135
                 TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaks 93 
                         +kkdrhski T+ g+RdRR+Rls+++a++fFdLqd+LGfdk+sktieWL++++ +aik+ ++ s +++  ++++ss ++  n+++++++k 
  Bv6_141360_mzxu.t1  92 TKKDRHSKINTAHGPRDRRMRLSLHIARKFFDLQDMLGFDKASKTIEWLFNKSRAAIKDVAEKSCTTN-IVDPSSSLEELINDRNNNKEKL 181
                         79*************************************************************55555.4455555555555666656666 PP

                 TCP  94 aa.kskksqksaasalnlakesrakarararertrekmriknk 135
                         ++  s+k++++   +ln++ e+r++arararert+ek  i+++
  Bv6_141360_mzxu.t1 182 SEsMSRKKESKGGIMLNVN-EKRKEARARARERTKEKLLIQKQ 223
                         6536666666666666665.6999**************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.7E-3792217IPR005333Transcription factor, TCP
PROSITE profilePS5136935.43393151IPR017887Transcription factor TCP subgroup
PROSITE profilePS513709.401200217IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MFDPDYNNAN NSFDQGSSHP FDDHLLNNFP SHLLDDEQLF IDTILTYQPP PPPPTPLLLI  60
NKHLIEENSS EKTVAKEIKK KANNGVGSKR RTKKDRHSKI NTAHGPRDRR MRLSLHIARK  120
FFDLQDMLGF DKASKTIEWL FNKSRAAIKD VAEKSCTTNI VDPSSSLEEL INDRNNNKEK  180
LSESMSRKKE SKGGIMLNVN EKRKEARARA RERTKEKLLI QKQGKEKTLF VMKNKDPLEI  240
SEENPNSLIN SRIRVDNQQQ WRPLEDQMAS VGIIEKFLAA SSSMPTNFSQ DNGAFSMEME  300
QFGSYHVQPN VRYW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010681415.10.0PREDICTED: transcription factor TCP12-like
TrEMBLA0A0J8C8800.0A0A0J8C880_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.16e-29TCP domain protein 12